PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019086
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 315aa    MW: 35820.1 Da    PI: 8.9645
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019086genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd++l+  v+++G g+W+t + + g+ R++k+c++rw +yl
      Lus10019086  9 RGPWSSEEDQKLLSFVQLHGHGSWRTLPPKAGLQRCGKSCRLRWINYL 56
                     89********************************************97 PP

2Myb_DNA-binding55.51.3e-1762107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
      Lus10019086  62 RGKFTLHEEQTIIQLHALLGNR-WSAIAAHLP-RRTDNEIKNHWNTHL 107
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.587456IPR017930Myb domain
SuperFamilySSF466891.31E-296103IPR009057Homeodomain-like
SMARTSM007171.8E-11858IPR001005SANT/Myb domain
PfamPF002497.5E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-221063IPR009057Homeodomain-like
CDDcd001677.02E-91156No hitNo description
PROSITE profilePS5129426.02657111IPR017930Myb domain
SMARTSM007171.1E-1661109IPR001005SANT/Myb domain
PfamPF002494.8E-1662107IPR001005SANT/Myb domain
CDDcd001672.93E-1164107No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2664111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDMSAGLRRG PWSSEEDQKL LSFVQLHGHG SWRTLPPKAG LQRCGKSCRL RWINYLRPGI  60
KRGKFTLHEE QTIIQLHALL GNRWSAIAAH LPRRTDNEIK NHWNTHLKKR LSLMGIDPTT  120
HKSKTAALRR LDGGDPKNAS TLSHMAQWES ARLEAEARLV RESNLLRVDH HQQQLNPAHH  180
HHHDQVMLNK MSNSRLAPQA RCLDVLRVWQ NQHNNFEGHD GHHHDTNIYT WHSSSSPPWP  240
RLMESTLLDG GRASTTISSG ARGINLVGKS VAQVSNDDEA GDALFVDYWT RNDDCELFDL  300
QVDWNSTSWA AMDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-2771115108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438735.14e-95hypothetical protein CICLE_v10033327mg
RefseqXP_012461180.12e-95PREDICTED: myb-related protein Myb4-like
TrEMBLA0A067GTE94e-95A0A067GTE9_CITSI; Uncharacterized protein
TrEMBLA0A0D2VCI03e-95A0A0D2VCI0_G
TrEMBLV4TK164e-95V4TK16_9R
STRINGGLYMA07G35561.19e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.18e-91myb domain protein 106